PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G0842
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family YABBY
Protein Properties Length: 216aa    MW: 24052.5 Da    PI: 7.5318
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G0842genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY230.54.3e-71111772169
        YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfk.vvtvrCGhCtsllsvnlakasqllaaeshldeslkee..lleelkveeenlksnvekeesastsv 96 
                  d+ s ++q+Cyv+CnfC+t+lavsvP +slf+ +v vrCGhCt+llsv+++     +a + hl +s+  +  llee ++ +   ++ ++++ +++ +v
  Gh_D11G0842  11 DHLSPPDQLCYVHCNFCDTVLAVSVPCSSLFNnTVMVRCGHCTNLLSVDMRGLLLPTANQLHLAHSFFTPqnLLEEIRSCGPP-NMVMINHPNPNDTV 107
                  68899*************************9549****************999999999999999987653466777665543.33333333333332 PP

        YABBY  97 sseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfg 169
                          e ee++++p v+rPPekrqrvPsaynrfikeeiqrika+nPdishr+afsaaaknWahfP+ihfg
  Gh_D11G0842 108 IR---GAAELEEIAKPPVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHRDAFSAAAKNWAHFPRIHFG 177
                  22...57899*****999******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.9E-6715177IPR006780YABBY protein
SuperFamilySSF470956.68E-8122172IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.2E-4126172IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MSSSSVSFSS DHLSPPDQLC YVHCNFCDTV LAVSVPCSSL FNNTVMVRCG HCTNLLSVDM  60
RGLLLPTANQ LHLAHSFFTP QNLLEEIRSC GPPNMVMINH PNPNDTVIRG AAELEEIAKP  120
PVVNRPPEKR QRVPSAYNRF IKEEIQRIKA GNPDISHRDA FSAAAKNWAH FPRIHFGQMP  180
DQAVMKMKNN VRQQEGEEAV VKDGFFVPTN VGVSPY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489748.11e-161PREDICTED: axial regulator YABBY 1-like
SwissprotO221523e-84YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A0D2QP841e-161A0A0D2QP84_G
STRINGVIT_15s0048g00550.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22172877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.16e-82YABBY family protein